SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008942 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008942
Domain Number 1 Region: 10-136
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-32
Family SH2 domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 526-607
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.93e-20
Family Protein kinases, catalytic subunit 0.00000351
Further Details:      
 
Domain Number 3 Region: 146-192
Classification Level Classification E-value
Superfamily SH2 domain 0.00000148
Family SH2 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008942   Gene: ENSEEUG00000009804   Transcript: ENSEEUT00000009812
Sequence length 607
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6306:6046:76985:1 gene:ENSEEUG00000009804 transcript:ENSEEUT00000009812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDIGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIERELNGTYAIAGGRTHGSPAELCHYHSQESDGLVCLLKKPYNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQI
VLIGSKINGKFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLV
EHYSYKPDGLLRVLTVPCQKIGGQAGNITFGARPQLPISHPATWSAGGIISRIKSYSFPK
PGHRKTTSTQGNRPESTFNPYEPDRGPWVTDRDAQREALPMDTEVYESPYADPEEIRPKE
VYLDRKLLTLEENELGSGNFGTVKKGYYHMKAVKTVPVKILNEANDPALXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQTHGKWPVKWYAPECI
NYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPPGCPREMYEL
MNLCWTY
Download sequence
Identical sequences ENSEEUP00000008942 ENSEEUP00000008942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]