SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009005 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009005
Domain Number 1 Region: 311-485
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-63
Family SPRY domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 42-94
Classification Level Classification E-value
Superfamily RING/U-box 0.0000112
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009005
Domain Number - Region: 98-127
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000113
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009005   Gene: ENSEEUG00000009866   Transcript: ENSEEUT00000009882
Sequence length 488
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_212527:8871:22661:1 gene:ENSEEUG00000009866 transcript:ENSEEUT00000009882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSDTNPLGNYPDVDDLVTETKVQIKDIYELHALCNDFRDPLRSCGHNCQACIQNFWKQQA
KETFCPECKMLCPYSNCTFNLVLEKLVEKIKKLHSLKSHPQCPEHGENLKLFSKPDGKLI
CFQCKDARLSAEQSKEFLLVSDAVSFFTXXXXXXXXXXXXXXXXXXXXXXXQKDAIAAYK
ENKLQLQQHISLEFLKIHQFLHNKEKDILNELREEGKALSEEMEQNLNELQDQYLFAKEM
LMRIQSQMDQQNSFDFLQDITVLLDSLDKGMRALAPRELISRKLNPGLFRGPIQYMIWRE
MESTLSPGLSALTLDPKTAHPNLVLSKNRTSVWHGDIKQAIPDDPERFDSSVAVLGSKGF
TSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRNQTDLKALDFPSCS
LKLTNNLNKVGIFLNYEGGQVSFYNAKTMTHIYTFSSTFSEKVYPYFCPCLNDGGENKEP
LHILHPQI
Download sequence
Identical sequences ENSEEUP00000009005 ENSEEUP00000009005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]