SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009024 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009024
Domain Number 1 Region: 162-199,227-264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000112
Family I set domains 0.046
Further Details:      
 
Domain Number 2 Region: 114-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000119
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009024   Gene: ENSEEUG00000009903   Transcript: ENSEEUT00000009903
Sequence length 277
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1001:82783:154302:-1 gene:ENSEEUG00000009903 transcript:ENSEEUT00000009903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPPLGLLLGAAGLLLLLLPSLFSFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPVCG
SDGTTLPSGCQLRAASLRAESRGEKGVTQVSKGTCEQGPSIVTPPKAIWNVSGQVYLSCE
VGIPTXXXXXXXIKRGHNEVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDA
GEYECHASNSLGQASASANITVVDSLHEIPVRKGDNL
Download sequence
Identical sequences ENSEEUP00000009024 ENSEEUP00000009024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]