SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009025 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009025
Domain Number 1 Region: 1-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-88
Family IMD domain 0.000000326
Further Details:      
 
Domain Number 2 Region: 345-424
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000788
Family SH3-domain 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009025   Gene: ENSEEUG00000009894   Transcript: ENSEEUT00000009904
Sequence length 509
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6270:2303:64331:-1 gene:ENSEEUG00000009894 transcript:ENSEEUT00000009904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGPEEVSRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVTAMILAGKAYYDGVAKIGE
MAAGSPVSTELGLVLIEISNTHKKLNESLDENFRKFHKEIIHELERKTELDVKYMNATLK
KYQTEHRSKLDSLEKSQAELKKIRRKSQGGRNALKYEHKEIEYVETVTSRQSEIQKFIAE
GCKEALLEEKRRFCFLVDKHCSFANHIHHYHLQSAELLNSKLPRWQETCGDATKVPEKIM
NMIEEIKTPISTPVSGTPQPSPMVERSSMVGKEYDTLSKHSPKMPLAPSARAYSGPLIDM
FNNPATVAQNSQNSERTNNSTDPSDDPSLQRSISVATGLNMMKKQKVKTIFPHSAGSNQT
LLSFSQGDVITLLISDEKDGWLYGEHDDTKVRGWFPSSYTKLLEENAKEPVSMPKPSPLP
VVRSISTVNLAEKSSVVIPPPDYLECLSQGAAAPKSTSIFKAPAPKLEATSPNDANGIAK
PPFLSGENPFATVKLRPTVTNDRSAPVIR
Download sequence
Identical sequences A0A1S3AML5
XP_007537634.2.11023 ENSEEUP00000009025 ENSEEUP00000009025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]