SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009082 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009082
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-31
Family Dcp1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009082   Gene: ENSEEUG00000009966   Transcript: ENSEEUT00000009962
Sequence length 556
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5857:379:32212:-1 gene:ENSEEUG00000009966 transcript:ENSEEUT00000009962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWXXXXXXXXXXXXXXS
ASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAK
LMADVVEEEAQRSQQAAREKQSPNQANGCSDHRPIDILEMLSRAKDEYERNQMVDSNISS
PGLQPGTQLSNLASTETLEEMLSGSQDKSAPSGQKHLTVEELFGTSLPKEQPTVVGLDSE
DMEKMPGEASLKEPSSFLPFSFEQPGGASQSENLGVHAPTHHPLQPEVTGPVLITPASIT
QANEKQAPGYVIPLQPVLSPTLPTEAPTAQVPPSLPRNTTLMQAVKTTPRQRSPLLNQPV
TELSHTSLTATQSPFRTPLCVTNTTGTSLPSIELLQKLRLTPQHDQIQTQILGKSTMAPS
FSPAAGQLATPESFIEPSPKTATRATASASLSNMVLAPLQXXXXXXXXXXXXXXXXXXXX
XXXXVTSSPLATVTTTGSSVLLSPSVFQQTVTRSMDLERKASSPSPLTVGTPENQRKPSI
ILSKSQLQDTLIHLIK
Download sequence
Identical sequences ENSEEUP00000009082 ENSEEUP00000009082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]