SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009145 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009145
Domain Number 1 Region: 106-170
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000222
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 202-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000474
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009145
Domain Number - Region: 7-35
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009145   Gene: ENSEEUG00000010038   Transcript: ENSEEUT00000010028
Sequence length 316
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4714:10228:312771:-1 gene:ENSEEUG00000010038 transcript:ENSEEUT00000010028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXAGSGSGDGGHEGSGEANQKETSTCDICQFGAECDEDAEDV
WCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQERIEVMSLGRCEDNTTTTTKSE
DGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSVNMQEPSCRCDAGYTGQ
HCEKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNT
GHYSSDNTTRASTRLI
Download sequence
Identical sequences ENSEEUP00000009145 ENSEEUP00000009145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]