SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009155 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009155
Domain Number 1 Region: 99-226
Classification Level Classification E-value
Superfamily EF-hand 4e-22
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 2 Region: 14-130
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000011
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009155   Gene: ENSEEUG00000010037   Transcript: ENSEEUT00000010040
Sequence length 260
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1690:3545:95801:-1 gene:ENSEEUG00000010037 transcript:ENSEEUT00000010040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLDLSPEMKT
FVDPYGQKDDKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETE
ELKNFLKDLLEKANKVVDDIKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKF
QGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNITTYKKNIMAL
SDGGKLYRTDLALILCAGDN
Download sequence
Identical sequences ENSEEUP00000009155 ENSEEUP00000009155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]