SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009196 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009196
Domain Number 1 Region: 19-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-76
Family Ephrin receptor ligand binding domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 321-526
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-38
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 3 Region: 613-739
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-34
Family Protein kinases, catalytic subunit 0.00000219
Further Details:      
 
Domain Number 4 Region: 871-941
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-19
Family SAM (sterile alpha motif) domain 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009196
Domain Number - Region: 251-318,353-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00011
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009196   Gene: ENSEEUG00000010051   Transcript: ENSEEUT00000010083
Sequence length 946
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5459:8566:348206:1 gene:ENSEEUG00000010051 transcript:ENSEEUT00000010083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGSESTSLVIAPGTCIPNAEEVDVPIKLYC
NGDGEMLPIVRCTCKLVYEPENSVACKACPAGMFKANQEAEGCSHCPSNSRSPAEASPIC
TCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRESGGRDDVTYNIICK
KCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAVNGVSGKSPFPPQ
HVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNS
SMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPL
IAGSAAAGVVFIVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTYE
DPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYGVVTKSRPVMIITE
FMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVC
KVSDFGLSRYLQDDTSDPTYTSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXRPYWDSPNQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXPSQPLLDRSIPDFKAFATVDDWLGAIKMVQYRDSFLTAGFT
SLQLVAQMTSEDLLRIGITLAGHQKKILNSINSMRVQMNQSPTTMA
Download sequence
Identical sequences ENSEEUP00000009196 ENSEEUP00000009196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]