SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009336 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009336
Domain Number 1 Region: 23-139
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.14e-24
Family Mitochondrial carrier 0.00077
Further Details:      
 
Domain Number 2 Region: 250-297
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.00000000235
Family Mitochondrial carrier 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009336   Gene: ENSEEUG00000010249   Transcript: ENSEEUT00000010236
Sequence length 300
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8953:33068:36632:-1 gene:ENSEEUG00000010249 transcript:ENSEEUT00000010236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDTGEQVMVPVEVLEAQNRGALWQFLLSGAVAGAVSRTGTAPLDRAKVFMQVYSSKKHL
LNLQGGLRSLVQEGGLRSLWRGNGMNVIKIAPEYAIKFSVFEKVKDSLCGAHGSSMEEHL
LASSLAVATSQSLINPLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSIQGSAPSMRAIIGSILAQQGWRGFYRGLSPSLLKVLPAGGLSYVTYEAMKKALGI
Download sequence
Identical sequences ENSEEUP00000009336 ENSEEUP00000009336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]