SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009358 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009358
Domain Number 1 Region: 445-565
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.57e-44
Family STAT DNA-binding domain 0.0000406
Further Details:      
 
Domain Number 2 Region: 566-685
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-42
Family SH2 domain 0.0000289
Further Details:      
 
Domain Number 3 Region: 139-316
Classification Level Classification E-value
Superfamily STAT 4.12e-41
Family STAT 0.00019
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.06e-29
Family Transcription factor STAT-4 N-domain 0.00015
Further Details:      
 
Domain Number 5 Region: 316-369
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0000000000348
Family STAT DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009358   Gene: ENSEEUG00000010238   Transcript: ENSEEUT00000010261
Sequence length 699
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6923:4523:20202:-1 gene:ENSEEUG00000010238 transcript:ENSEEUT00000010261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLEGPFQEKLHRLYADSHLPVDVRQHLAAWIEDQNWEEAALGNDNAKADMLY
FHFLDQLSTEWGRYSQDPEHFLLSHNLRKFSRDIQAFTRGPTKLAEMIFNLLLEEKRILN
QAQRAQLEQEEPAPRAPVESQQHEIDSRTVELTTMMEKLVKSISQLKDQQDVFLFRYKAH
PPERVSSLHPRQTRELQLLQETANELDKRRKEVLDTSKALLGRLTTLVELLLPKLEEWKV
LQQKACIGAPPQQGLEQLEQWFTDGAKLLFHLRQLLKELKGLSALVKYKGDTLPQGVSLL
EAQVTELLQRLLHRAFVVESQPCMAQTSHRPLVLKTGSKFTVRTRLLVRLQEGSESLTTE
VFIDKPQSQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXTDTLPVVIISNMNQLSVAWASVIWFNLLSSKPQNQ
LFFSNPPKAPWSLLGPALSWQFLSYVERGLNEEQLNMLRNKLFGQNSKKEDASLSWADFI
KRESPPGKLPFWTWLDKILDLVHDYLKDLWKDGWIMGFVSRSQEHRLLKKTISGTFLLRF
SETSSEGGITCSWVEHQDDDKVVIYSVQPYTKEVLQRLPLTEIIRNYQLLTDENIPENPL
CFLYPRTPRDEAFGRYYQEKVNLQEQRKYLKRRLIVVSN
Download sequence
Identical sequences ENSEEUP00000009358 ENSEEUP00000009358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]