SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009390 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009390
Domain Number 1 Region: 227-336
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-25
Family Pleckstrin-homology domain (PH domain) 0.00000396
Further Details:      
 
Domain Number 2 Region: 123-219
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-19
Family DEP domain 0.0000204
Further Details:      
 
Domain Number 3 Region: 4-52
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000536
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009390   Gene: ENSEEUG00000010296   Transcript: ENSEEUT00000010298
Sequence length 338
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3742:15561:37596:-1 gene:ENSEEUG00000010296 transcript:ENSEEUT00000010298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHIVHNWKVRWFILQQNTLLYYKLEGGQKVTPPKGRILLDGCTITCPCLEYENRPXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYIMD
KRHDSRGIRSIPNMKQGSPFNKPFGGSSLVDWLISNTFSANRLEAVTLASMLMEENFLKP
VGSRSLGAIRSGDLVEQFLDDSTALYTFAESYKKKSSPKEEIDLSSVELSGTVVKQGYLA
KQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEESRPVGGFSLRGSLVSALEDNGVPTGVKG
NVQGNLFKVITKDDTHYYIQASSKAERVEWIEAIKKLT
Download sequence
Identical sequences ENSEEUP00000009390 ENSEEUP00000009390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]