SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009412 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009412
Domain Number 1 Region: 17-161
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.1e-32
Family Mitochondrial carrier 0.0025
Further Details:      
 
Domain Number 2 Region: 207-313
Classification Level Classification E-value
Superfamily Mitochondrial carrier 9.29e-26
Family Mitochondrial carrier 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009412   Gene: ENSEEUG00000010317   Transcript: ENSEEUT00000010324
Sequence length 323
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5348:308:25564:1 gene:ENSEEUG00000010317 transcript:ENSEEUT00000010324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPEDEENPVPLAQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAQLGE
CAQQSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHIVYSGGRMVTYEHLREVVFGKS
EDKHYPLWKSVIGGMLAGVIGQFLANPTDLVKVQMQMEGRRKLEGKPLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLTTYDTVKHYLVLNTTLEDNIMTHGLSSFCSGL
VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM
TPWSLVFWLTYEKIRDMSGLTPF
Download sequence
Identical sequences ENSEEUP00000009412 ENSEEUP00000009412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]