SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009460 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009460
Domain Number 1 Region: 445-468
Classification Level Classification E-value
Superfamily Notch domain 0.0000902
Family Notch domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009460
Domain Number - Region: 969-1035
Classification Level Classification E-value
Superfamily EF-hand 0.00691
Family Parvalbumin 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009460   Gene: ENSEEUG00000010316   Transcript: ENSEEUT00000010375
Sequence length 1251
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2231:801:59161:-1 gene:ENSEEUG00000010316 transcript:ENSEEUT00000010375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFRELVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNVTEPTK
KSEKQLECLLTHCIKVPMLVLDPALPANVTLKDLPSLYPSFHSATDFFNVAKPKNPSTNV
SIVVFDSTKNVEDAHTGVFKGNSKQMIWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
NQLKAKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTIDGKELTINPA
YLLWDLSAISQSKQDEDVSASCFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTRQDIFRNLSHLPTFSSPAIESHIHRIKGLSQKFIYLNNDVMFGKDVWPDDF
FSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHF
HELYKVTLLPNQTHYVIPKGECLPYFSFAEIAKKGVEGAYSDNPIIRHASIANKWKSIHL
LMHRGMNTTTLHFNLTFQRENNEEFKIQIAVEVDTREEPKLNFTTPKPYQNLASSITPLP
EADSLFEEIPEEKRYPKVKRRDANTTGQFQEEVKIPVVNMLLLPKEVQLSLSHLDLQLEL
GDITMKGYNLSKSALLRSFLVKDADGKQNQSLTTHGRNDSLEAPLEEQVHQSILPGVLER
SLRFTAPPVTMKVTGHHQSQNPPPDLATSSRFRXXXXXXXXXXXXXXXXXXXXXXXPLEN
YSTKEKTLGNEQKTNRMEGDSKNHISVIEVLPGRKLQCYRDSYGGFLPWEKKKYFQDLLD
KEQSLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNRKFGFTSRKVPAHMPHMIDRIV
MQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVL
SDREIRTLATRIHDLPLSLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP
VTKNLVTNCKPVTDKIHKAYKAKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAYR
DKLKFWTHCVLATLILXXXXXXXXXXLIALKRKLFPRRRIQKEASPDRIRV
Download sequence
Identical sequences ENSEEUP00000009460 ENSEEUP00000009460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]