SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009502 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009502
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-41
Family Necap1 N-terminal domain-like 0.00000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009502   Gene: ENSEEUG00000010429   Transcript: ENSEEUT00000010420
Sequence length 275
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1129:8511:20938:1 gene:ENSEEUG00000010429 transcript:ENSEEUT00000010420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGXXXXXXXXXXXXX
XXXXXXXXWVKQESEISKESQEMDSRPKLDLGFKEGQTIKLSIGNITTKKGGASKPKTAG
GGGLSLLPPPPGGRVTIPPPTSSVAISNHVTPPPIPKSNHGGSNAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSVPNQAPQPSNWVQF
Download sequence
Identical sequences ENSEEUP00000009502 ENSEEUP00000009502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]