SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009504 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009504
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-53
Family SPRY domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009504   Gene: ENSEEUG00000010450   Transcript: ENSEEUT00000010422
Sequence length 180
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7226:178:2682:1 gene:ENSEEUG00000010450 transcript:ENSEEUT00000010422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLG
TVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQI
GERIRVILDMEDKTLAFERGYEFLGVAFRGLPKACLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences K7GDK4
ENSSARP00000006188 ENSSARP00000006188 ENSPSIP00000018365 ENSEEUP00000009504 ENSPSIP00000018365 ENSEEUP00000009504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]