SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009524 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009524
Domain Number 1 Region: 40-180
Classification Level Classification E-value
Superfamily EF-hand 3.41e-31
Family Calmodulin-like 0.00000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009524   Gene: ENSEEUG00000010459   Transcript: ENSEEUT00000010446
Sequence length 180
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8491:55:14787:1 gene:ENSEEUG00000010459 transcript:ENSEEUT00000010446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKPEPKKEAAKPTPAAAPVPEPPKEPVFDPKSIKIDFTADQIEEFKEAFSLFDRTPT
GEMKVTYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNSKMLDFETFLPILQHISRNKE
QGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYE
Download sequence
Identical sequences ENSEEUP00000009524 ENSEEUP00000009524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]