SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009592 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009592
Domain Number 1 Region: 579-716
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000207
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 2 Region: 397-450
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000000000706
Family Sec7 domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009592
Domain Number - Region: 547-579
Classification Level Classification E-value
Superfamily Sec7 domain 0.0379
Family Sec7 domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009592   Gene: ENSEEUG00000010472   Transcript: ENSEEUT00000010522
Sequence length 722
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2914:9181:45545:1 gene:ENSEEUG00000010472 transcript:ENSEEUT00000010522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLENPVRAVLYLKELTAIVQNQQSLIHTQRQRIDELERRLDELSAENRSLWEHQQLL
HAQPPPGLESPAPAGPAAASASSEAPQYRGQLPPAAPEQPPAQHHGQLPAQPPGPGARAP
APPAPHQHPAPPGAAADKDKDKERPPACCAAAGALLQHKPPALGKGVLGRRPENETVLHQ
FCCPAADAEQKPACSDLGSHSDGSCAAGGGTEDAAAAAGTPSAQAPKAQARELQEQEERP
GSGGGSPRAGPRAASPGLCPQGAGGSEYQLSRELENKKIEMLEHKYGGHLVSRRAACTIQ
TAFRQYQLSKNFEKIRNSLLESRLPRRISLRRGRAAGGPALLDSCALLGLRPAGALTELE
GSFAEQVQALAKSIDDALSSWSLQAVCSLQDAARPPNPDKGIQFLISRGFIPDTPIGVAH
FLLQRKGLSRQMIGEFLGNSKKPFNRDVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVDDGADIPRELVAGIYERIQQKELRSNEDHVTYVTKVEKSIVGMKTVLSMPHR
RLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILKLCPKKKSASTYTFCRAVGLLGM
QFQLFENEYYSHGITLVTPLLGSDRKQVLHFCALGSDEMQKFVEDLKESIAEVTELEQIR
IE
Download sequence
Identical sequences ENSEEUP00000009592 ENSEEUP00000009592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]