SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009655 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009655
Domain Number 1 Region: 438-675,707-774
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.35e-47
Family Diacylglycerol kinase-like 0.022
Further Details:      
 
Domain Number 2 Region: 5-99,129-156
Classification Level Classification E-value
Superfamily EF-hand 4.55e-40
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 
Domain Number 3 Region: 131-221
Classification Level Classification E-value
Superfamily EF-hand 5.84e-19
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 4 Region: 226-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.12e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 299-362
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009655   Gene: ENSEEUG00000010541   Transcript: ENSEEUT00000010595
Sequence length 803
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4009:3810:259657:-1 gene:ENSEEUG00000010541 transcript:ENSEEUT00000010595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNQEKWSHISPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGXXXXXXXTIDF
EGFKLFMKTFLEAELPDDFTTHLFMSFSNKFPHSSPLTKNKPSLLSGGLRMNKGAATSPR
TSPANMCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQM
MHXXXXXXXXXXXXXXILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVKD
DGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKS
KKNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCG
PLKDHILPPTTICPVVLQTLPSSGVSVCEDRQTTAKKDKTVSQSSNKVTTDKNKMQRANS
LTVDGQGLQINPVPGTHPLLVFVNPKSGGKQGERIFRKFQYLLNPRQVYSLSGNGPMPGL
NFFRDVSNFRVLACGGDGTVGWILCIEKANVVKHPPVAILPLGTGNDLARCLRWGGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEKGDPVPYSIINHYFSIGVDASIAHRFHI
MREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIELINISLEGIAI
LNIPSMHGGSNLWGESKKRRSHRRIEKKETDKRTTLTDAKELKFASQDLSDHLLEVVGLE
GAMEMGQIYTGLKSAGRRLAQCSSVVIRTSKSLPMQIDGEPWMQTPCTIKITHKNQAPML
MGPPPKSGLFCSIIQRTRNRSKE
Download sequence
Identical sequences ENSEEUP00000009655 ENSEEUP00000009655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]