SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009722 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009722
Domain Number 1 Region: 777-844
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000636
Family IBR domain 0.0000201
Further Details:      
 
Domain Number 2 Region: 64-127
Classification Level Classification E-value
Superfamily PUG domain-like 0.00000209
Family PUG domain 0.009
Further Details:      
 
Domain Number 3 Region: 857-929
Classification Level Classification E-value
Superfamily RING/U-box 0.0000129
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Domain Number 4 Region: 347-373
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000145
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 
Domain Number 5 Region: 706-759
Classification Level Classification E-value
Superfamily RING/U-box 0.0000318
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009722
Domain Number - Region: 572-610
Classification Level Classification E-value
Superfamily UBA-like 0.000232
Family UBA domain 0.012
Further Details:      
 
Domain Number - Region: 406-430
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000628
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 
Domain Number - Region: 298-323
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000667
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number - Region: 211-242
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0136
Family TFIIH p44 subunit cysteine-rich domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009722   Gene: ENSEEUG00000010593   Transcript: ENSEEUT00000010669
Sequence length 1068
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1188:66231:90496:1 gene:ENSEEUG00000010593 transcript:ENSEEUT00000010669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKEEEQAFLEAREELASALRKDSGQTFALEQLWPLLVTSLPPAARYLQLDAARLVRCN
AHGKPRNYLSTLSTALNILEKYGRNLLSLQRPRYWRGVKFNNPVFHSTVDAVQGGRDVLQ
FYVYEEQDALSFSVQERPDIQVATVHLEXXXXXXXXXXXXXNTHPRQQALEQLLNDKVED
DMLQFSEFAPLLREIVPASLTTPSAPGPTPGPCFLCGSAPGTLHCSSCKHTLCSTCDSLF
HSHPSRALHLRQTLPAISQAPQLTPSLPVSAPARPQSTSLLVLGDNSLSSPDPSITRLPW
QCAACAMLNEPWAVLCAACERPRGCKGLGLRVEAPQGAGSQEPELPRERWACQSCTFENE
AAAVLCAMCERPRLAQPPSLVADSQDADVCLQPHQQENALLSSAQTRVWSCVHCTFCNSG
PGLVCAMCNRTGSSIPGHHTPCPQAKSLEEGLREPGPSRCLSAPPPSFCGDLEKQHQDKM
REQGLQLVKKIREGEAAGACPEEVFSALQYSGTEVPLQWLHSELPYVLEMVAEVAGQRAP
ALGAFSCQEARKAWLDRHGNLEEAVEECVRARRRKVQELCSLGFGPEEGSLQALFQHGGD
VARALTELQRQRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQALTSCECTICPD
CFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKK
LTEAVLMRDPKFLWCAQCSFGFIFEREQLEATCPQCHQTFCVRCKRQWEEQHQGRSCEDF
QNWKRNNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNT
FYAKNKCPDPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNIMFNTEPPAGARAV
PGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLYEVE
ELKSAVERYLHVHFQPLAGEEAPNYHARLLQKLTEEVPLGQSIPRRRK
Download sequence
Identical sequences ENSEEUP00000009722 ENSEEUP00000009722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]