SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009752 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009752
Domain Number 1 Region: 7-84,178-248
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000792
Family Calmodulin-like 0.054
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009752
Domain Number - Region: 1734-1808
Classification Level Classification E-value
Superfamily Tropomyosin 0.00222
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 293-346
Classification Level Classification E-value
Superfamily EF-hand 0.0248
Family Polcalcin 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009752   Gene: ENSEEUG00000010609   Transcript: ENSEEUT00000010705
Sequence length 2052
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1386:15971:172852:-1 gene:ENSEEUG00000010609 transcript:ENSEEUT00000010705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVEQDQHEARLKELFDSFDTTGMGSLGLEELTDLCHMLSLEEVGPVLQETLLQDNLLG
RVHFDQFKEALIVILSRTLSNDEQFQEPDCSLEAQPKYVRDGKRYGRRSLPEFQESVEEF
AEVTVIEPLDEEAQPSHIQASDHDEHWKTQPSEEYEAEGQLRFWNPDDLNASQCGSSPPH
DWIEDKLQEVCEDLGITRDGHLNRKKLISICEQYGLQNVNGEMLEEVFHNLNPTGTMSVE
DFFYNLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRTTTPSAMTSTIGFRVFSCLDD
GMGYASVEKLLDTWQEEGIENSQEILKTLDFSLDGNVNLTELTLALENELLVTKNSIHQA
ALASFKAEIRHLLERVDQVVREKEKLRSDLDKAXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEN
SRLENELMENAEKLAEYENLTNKLQRNLENVLTEKFGDLDPSSAEFFLQEERLTQMRNEY
EQQCRVLQDQVDELQSELEEFRMQGKVLRLPLQNSLSEELDINSGCIERDQGFGSEECNP
LNLSIEAELVIEQMKEQHHRELYCLRIELEDKVHHYEKQLDETKVACEKEQENMKQKYEN
EAFTLEKQISDLQNDIVELQRQTVVLKEAQHATTCRHEEEKKELQLKCDEEKTCLKETLR
LEYELELKARLEQAEESFNQEREGLNQNGTWTEEKVKVMTQELEQFHQEQLKSLVEKYTL
EKEELQKELLEKHQRELLEEREKMESECNRRTSQIEAQFQADCQKVNEKCKDVLYRLEGH
FHRELKDLQEQHHEERSHWEFEKDELTQECAEIRELLRETLQKEKATSLVLTQEREILEK
NYKAHVDSMVVEREQLLKDLEDLKNVSQSQQNLLCDQILELKSSHKQEPKDHEQLLCQAS
TSKQLERLEMEHDQEKQRMVAKLLAMENSHKVTCEKADRERAEMSTEISRLQNKIKEMQQ
VTSLPLHSGCQAVGGEETEGSGAMSLLQQGEQLLEENGGVLLSLQRAHERAVKENVKMAT
EILRLQQRLWKLEPGSVMSSGLDESTIGFFGNAVKQTEPFLEQNRMKQVEGATRLQSLSD
PQNDEVQDLGSTAASSAQKQRVKIGESDTSVESFSELENSEDTRTETWDLKNQISQLQEQ
LIILRADCDRASEKKQDLLFDISVLKKKLKMLERIPESSLKYKLLYEDASRENDCLQEGL
RVMETRYDEALENNKELTSEVFQLQNELKKVEEVTETFLSLEKSYDEVKRENEELHVWVL
RLQNKIEKLQERAVPQCDCFSQWEANLDNLEVNPGGKVLDSCQTPAECFPKVMNVHQIIE
HYQENQFIDQENTPLLEKVKAHEIAWFHRTIQTHQEKPAIQHQVILEENTALLSLQDKHL
QRQVTIAELELEKQKLQELTRKLRERVTILVKHKDVPSQGEKEEELKAMMHDLQVTCSEM
QQKVELLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXISQLKTKNQQLDLANAELSQKNSQNQKELQELNQRLAEILCQKEEEP
EHSTFEEWEQEKSNLKEELEHCQVQSSSLVSSLEAELSEVKIQTHIVEQENLLLKDELEK
MKQLHRCPDLSDFQQKISSVLSYNEKLLKEKESLNEELNRYMDKLAKSRILEHQIAVMKQ
DHKSWEHQSESLKSQLVASQEKVQSLEDTLQNVNLQMSQIKSDLRMTQQENETLKQEVMS
LHKKLQNAGDKNWALEISGIHNPQQRTSWDKLDSLMNGEPQLLWQENERLQAVVQNTKVE
LTHPRDKVRQLESNLLPSKHQRHLSPSSSVKPTEQEKLNLKRECEQFQKEQSANKKVDQI
NSIEQELETVHLENEGLKKKHVKLDEQLIEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQEQLVMVMERMIVEQKLLVKG
FXXXXXXXLKEQ
Download sequence
Identical sequences ENSEEUP00000009752 ENSEEUP00000009752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]