SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009785 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009785
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily EF-hand 3.46e-20
Family S100 proteins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009785   Gene: ENSEEUG00000010771   Transcript: ENSEEUT00000010744
Sequence length 78
Comment pep:novel scaffold:HEDGEHOG:scaffold_211873:6947:7638:1 gene:ENSEEUG00000010771 transcript:ENSEEUT00000010744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FHQYSVRLGHSDTLSKGELMQLITKELANFLQHVIDQASVDKIFKDLDADQDTQVNFSEF
ANLMITLLLATHEEFHRG
Download sequence
Identical sequences ENSEEUP00000009785 ENSEEUP00000009785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]