SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009801 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009801
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.62e-22
Family Pyk2-associated protein beta ARF-GAP domain 0.0032
Further Details:      
 
Domain Number 2 Region: 26-59,112-283
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-21
Family Ankyrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009801   Gene: ENSEEUG00000010725   Transcript: ENSEEUT00000010762
Sequence length 743
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6607:10402:20853:-1 gene:ENSEEUG00000010725 transcript:ENSEEUT00000010762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASNGANSIWEH
SLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTSKDLSKQLH
SSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPDV
NGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADSLDLS
ELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQNHSTLVTERSAVPFLPVN
PEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSLSSPTDNLELSVRSQSDLD
DQHDYDSVASDEDTDQEPLRSAGTARNNRARSMDSSDLSDGAVTLQEYLELKKALATSEA
KVQQLMKVNSSLSDELRRLQREIHKLQAENLQIRQPPGPVPTTPLPSERAEHTPMGPSGS
AHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSAELEDDAIYSVHVPASLYRIRK
GVSASAVPFTPSSPLLSCSQEGSRHASKLSRHGSGADSDYENTQSGDPLLGLDGKRFLEL
SKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKI
HLAVTEMASLFPKRPALEPVRSSLRLLNASAYRQQSECRKTVPPPPGAPVDFQLLTQQVI
QCAYDIAKAAKQLVTITTREKKQ
Download sequence
Identical sequences ENSEEUP00000009801 ENSEEUP00000009801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]