SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009838 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009838
Domain Number 1 Region: 38-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-37
Family SPRY domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009838   Gene: ENSEEUG00000010824   Transcript: ENSEEUT00000010800
Sequence length 231
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8701:4102:9993:-1 gene:ENSEEUG00000010824 transcript:ENSEEUT00000010800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLRKTWRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLTLDPGTAHHRLLISPDRRS
VRLAPPGTPAPPDGPARFDQLPAVLGAQGFGAGRHCWEVETVGASSCGDSSGEEEDGGES
RYAVGAAGESVRRKGRIGLCPAGSVWALEGRGGRLWALTAPEPTPLGGAGPPPRRIRVDL
DWERGRVAFYDGRSLDLLFAFQAPGPLGERIFPLLCTHDPRAPLRIVPAEG
Download sequence
Identical sequences ENSEEUP00000009838 ENSEEUP00000009838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]