SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009866 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009866
Domain Number 1 Region: 280-392
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-29
Family Cadherin 0.00088
Further Details:      
 
Domain Number 2 Region: 174-278
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-26
Family Cadherin 0.0007
Further Details:      
 
Domain Number 3 Region: 69-172
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 833-917
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-17
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 380-511
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000228
Family Cadherin 0.003
Further Details:      
 
Domain Number 6 Region: 1101-1192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000145
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 7 Region: 505-590
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000799
Family Cadherin 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009866
Domain Number - Region: 1284-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 1939-2133
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00915
Family Rhodopsin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009866   Gene: ENSEEUG00000010741   Transcript: ENSEEUT00000010828
Sequence length 2425
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1374:18969:127965:-1 gene:ENSEEUG00000010741 transcript:ENSEEUT00000010828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLPPGGSARLHLLCALRRAAGAVRVQLHLQAAAATPSPSPSLSPSPPSLLRAGAGTARRA
RRGAGGSTSPQFPLPSYQVSVPENEPAGTAVIELRAHDPDEGEAGRLSYQMEALFDERSN
GYFLIDAATGAVSTARALDRETKDTHVLKVSALDHGSPRRSGATYLTVTVSDTNDHGPVF
EQSEYRERVRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAAGVFEIDARSGVVRTRA
VVDREEAAAYQLLVEANDQGRNPGPLSATATVHIVVEDENDNYPQFSEKRYVVQVPEDVA
VNTAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLR
IKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDAD
SGENSRLSYRLVDTASASPGVGRAGPQDPSAAFTLILFQLSLLNGDPRELENLNFEIRRE
YVLVQATSAPVVSRATVHIRLLDQNDNSPVLPDFQILFNNYVTNKSNSFPTGVIGRIPAH
DPDLSDSLNYTFLQGNELQLLLLDPATGELQLSRDLDNNRPLEALMEVSVSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEHCEVSVRSGRCAHGVCKNGGTCVNLLIGGFRCVC
PPGAYERPYCEVTTRSFPPQSFVTFRGLRQRFHFTVSLAFATQERNALLLYNGRFNEKHD
FIALEIVDEQVQLTFSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXMPHPQRFTGESVVSWSDLDITISVPWYLGLMFRTRKEDGVLLE
ATAGVSSRLHLQILNSYVHFEVSHGPSDVASMKLPRSRVTDGEWHHLLIELKSAKEGKDI
KYLAVMTLDYGLDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVRIGETS
TNIATLNMKDALKVRVKDGCDVEDPCASNPYPLHSRCHNTWDSFSCICDKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCPRAFEAGIWWLQTKFGQPAAVPCPKGSVXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNEKLNRNETRMDSDRTLRLAKALHNATQHTPTLFG
NDVRTAYQLLARILQHESQQQGFELAATRDADFHEDVVQVGSSLLAPGTRAAWELIHRSE
GGAGQLLQHFEAYFSNVARNVRRTYVKPFIIVTTNMILAVDVFNKFNFTGARVPRFQDVR
EEYPKELESSVIFPADFFKPAERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFLCTVIAILLHYVYMSTFAWTFVESLHVYRMLTEVRNIDVGP
MRFYYVVAWGIPAVITGLAVGLDPQGYGNPDFCWLSLQDTLIWSFAGPVGTVIIVNTVIF
VLSAKVSCQRKHHYYERKGIVALLRTAFLLLLLSSATWLLGLLAVNSDALAFHYLFAIFT
CLQGLFVLPFHCVLNREVRKHLKGVLAGKKPYPDDSATTRATLLTRSLNCNNTYIEEPNM
FRTALGESTASLDSTVRNEGGQKLSVASGLARGGHGEPDASFIPRSTKKPHDHDSDSDSE
LSLDEQSSSYASSHSSDSEEDGVEAEDKWDPALGPVHSTPKVDTVLNHISAGWPDESLAE
SDSEEPGEKPRLKVETKVSVELHQDGQGNHCREHPPEPGGSGGGGAPTKLPEQRKGILKN
KVTYPPPLVDKTLKSRLREKLAECEHSPASSRSSSLGSGDGVRAPDGAITVKTPRREPGC
EYHNGMAMNVRTGSAQANGSDSEKL
Download sequence
Identical sequences ENSEEUP00000009866 ENSEEUP00000009866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]