SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009879 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009879
Domain Number 1 Region: 27-75
Classification Level Classification E-value
Superfamily EF-hand 0.0000792
Family Polcalcin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009879   Gene: ENSEEUG00000010860   Transcript: ENSEEUT00000010841
Sequence length 95
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3875:50036:51858:-1 gene:ENSEEUG00000010860 transcript:ENSEEUT00000010841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPKKYLIALLERIKIAKLTGATFPNFMDHINISSMFGMMDTSNTRTISFVQYTEVLKTLG
LCTEDEVIEDDGSLITLEKFSSEVNKRTQKIWSAF
Download sequence
Identical sequences ENSEEUP00000009879 ENSEEUP00000009879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]