SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009894 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009894
Domain Number 1 Region: 77-173
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 215-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009894   Gene: ENSEEUG00000010877   Transcript: ENSEEUT00000010858
Sequence length 263
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_343210:48436:49462:-1 gene:ENSEEUG00000010877 transcript:ENSEEUT00000010858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPSLMAHPLPSRPCPLLAVERTGQRPLWARSLEPPESAMQPLPAGALLEEVAEETPAQP
ESESKELDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSY
LFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVTSCAADTRTD
SPDPAPTPALPTPKEDAPGDPALPAPAATAVHLKLVQPFVRRSSARSLQHLCRLVINRLV
ADVDCLPLPRRMADYLRQYPFQL
Download sequence
Identical sequences ENSEEUP00000009894 ENSEEUP00000009894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]