SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009909 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009909
Domain Number 1 Region: 356-418
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000879
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 143-196
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000115
Family IMD domain 0.00013
Further Details:      
 
Domain Number 3 Region: 2-94
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000858
Family IMD domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009909   Gene: ENSEEUG00000010866   Transcript: ENSEEUT00000010873
Sequence length 455
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7342:9090:32777:1 gene:ENSEEUG00000010866 transcript:ENSEEUT00000010873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIMEQFNPSLRNFIAMGKNYEKALAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVLFQ
MAEVHRQIQNQLEEMLKYFYELLMQLEQKVELDSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYIDAISNKQGELEGYVSDGYKTALTEERRRFCFLVE
KQCAVAKSSAAYHSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLSAQDNAPVMNGVSGPDGEDYNPWADRKSA
QSKASSPPQPQGKMSDSYSNTLPVRKSVAPKNSYATTENKTLPRSSSMAAGLERNGRMRV
KAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDG
SDRLHMSLQQGKSSSTGNLLDKDDLALPPPDYGTS
Download sequence
Identical sequences ENSEEUP00000009909 ENSEEUP00000009909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]