SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009997 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009997
Domain Number 1 Region: 66-136
Classification Level Classification E-value
Superfamily EF-hand 0.000000202
Family Calmodulin-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009997   Gene: ENSEEUG00000010977   Transcript: ENSEEUT00000010966
Sequence length 247
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_365690:2232:5919:-1 gene:ENSEEUG00000010977 transcript:ENSEEUT00000010966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPWTVRILVLLLPLSQAALKDGAIRLDPEVPNPFQQRGPEQLRFLQSYLKKLDRMEQEP
ESLSWEQVLLCMIALYDYDQNGQLDGLELMAMMPVVLAQGAAASHTANPVVLAVDKVLET
QDLDGDGLVTPTELISLPGQAPRNTEPRELPEPHGVGGQAPLAEAQEAPNPQEQAGAQVG
AGREFLEPLQEAQGQREAGEAPSLAGESWVQAEAECEEAGPPGGTLDAMPSPQELEVHAI
QVENDEM
Download sequence
Identical sequences ENSEEUP00000009997 ENSEEUP00000009997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]