SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010018 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010018
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily EF-hand 5.5e-26
Family Eps15 homology domain (EH domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 1116-1190
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-25
Family SH3-domain 0.0000159
Further Details:      
 
Domain Number 3 Region: 982-1040
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-19
Family SH3-domain 0.0000407
Further Details:      
 
Domain Number 4 Region: 897-958
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-18
Family SH3-domain 0.000018
Further Details:      
 
Domain Number 5 Region: 1047-1117
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.0000612
Further Details:      
 
Domain Number 6 Region: 1489-1550
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000084
Family Pleckstrin-homology domain (PH domain) 0.0000954
Further Details:      
 
Domain Number 7 Region: 1331-1360
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000811
Family DBL homology domain (DH-domain) 0.00098
Further Details:      
 
Domain Number 8 Region: 753-785
Classification Level Classification E-value
Superfamily SH3-domain 0.00000604
Family SH3-domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010018
Domain Number - Region: 1231-1267
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0262
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number - Region: 625-666
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0301
Family DBL homology domain (DH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010018   Gene: ENSEEUG00000010879   Transcript: ENSEEUT00000010989
Sequence length 1695
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8498:8242:97593:-1 gene:ENSEEUG00000010879 transcript:ENSEEUT00000010989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPSAMNGGPNMWAITSEERSKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPILA
EIWALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGKQVDSINGTLPSYQKIQDEEPQKKLP
VTFEDKRKANYERGNVELEKRRQALMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQL
ELEKRLEKQRELERQREEERRKEIERREAAKQELERQRRLEWERNGRQELLNQRTREXXX
XXXXXXXXXXXXXXXXXXNGKHQQISDRLQDARLRRQTQKTELEVLDKQCDLEIMEIKQL
QQELQDYQNKLNYLVPEKQLLNERIKNMQHSSTPDSEAGLLQKKSLEKEELCQRLKEELD
ALEKETASKLSEMDTCNSQLKGDLDDSILQCLVSPLSRLSQLLLLLKELRESYNTQHLAL
EQLQKIKRDKLKEMERKRSEQIQKKKLEDEAAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPASALVNYRALYRFEARNHDELSFNSG
DIIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQAVENL
KAQALCSWTAKKDNHLNFSKHDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGTEVKR
EXXXXXXXXXXXXXXXXXXXXXXXYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGS
IGDRTGIFPSNYVKPKDQESFGSASKSGTSNKKPEIAQVTSAYVASGSEQLSLAPGQLIL
ILKKNTSGWWQGELQGRRKKRTEGCFPPSHVKLGPSSERTTPALQPVCQVIAMYDYAANN
EDELNFSKGQLINVLSKDDPDWWQGEISGVTGLFPSNYVKMTTDSDPSQQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFQKRMAESGFLTEGEMALIFVNWKELIM
SNTKLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKLAADPRCQGMPLSSFLLKPMQRITRYPLLIRSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIFLNEVLVKL
PTDPSSDEPIFHISHIDRVYTLRTDNINERTAWVQKIKAASEQYINTEKSKREKPYQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFLGRTEVPLAKIHTEQESKGPTTRRLLLHEVSTGEV
WVRFDLQLFEQKTLL
Download sequence
Identical sequences ENSEEUP00000010018 ENSEEUP00000010018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]