SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010072 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010072
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.81e-27
Family G proteins 0.0021
Further Details:      
 
Domain Number 2 Region: 155-255,297-355
Classification Level Classification E-value
Superfamily EF-hand 6.91e-21
Family Parvalbumin 0.073
Further Details:      
 
Domain Number 3 Region: 463-567
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000355
Family G proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010072   Gene: ENSEEUG00000011020   Transcript: ENSEEUT00000011050
Sequence length 677
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3312:11865:109836:1 gene:ENSEEUG00000011020 transcript:ENSEEUT00000011050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQEIS
QANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILP
IMNQYTEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIF
KVSDQDNDGTLNDAELNFFQRICFNTPLAPQALEDVKNVVRKHISEGVADSGLTLKGFLF
LHTLFIQRGRHETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTF
DKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVCTNERGWITYQGFLSQWTLTTYLD
VQRCLEYLGYLGYSILTEQESQASAITVTRDKKIDLQKKQTQRNVFRRVIGMKTCGKSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHDISESEFLTEAEIICDVVCL
VYDVSNPKSFEYCARIFKQHFMDSRIPCLVIAAKSDLHEVKQEYSISPTDFCRKHKMPPP
QAFTCNTADAPSKDIFVKLTTMAMYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHA
RLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLHRHVTQADLKSSTFWLRASFGAT
VFAVLGFAMYKALLKQR
Download sequence
Identical sequences ENSEEUP00000010072 ENSEEUP00000010072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]