SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010131 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010131
Domain Number 1 Region: 33-188
Classification Level Classification E-value
Superfamily EF-hand 9.65e-45
Family Penta-EF-hand proteins 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010131   Gene: ENSEEUG00000011121   Transcript: ENSEEUT00000011112
Sequence length 190
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_121:250433:267575:-1 gene:ENSEEUG00000011121 transcript:ENSEEUT00000011112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYPGHPGASGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQ
SGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTV
DPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQ
QGVVNFPYDD
Download sequence
Identical sequences ENSEEUP00000010131 ENSEEUP00000010131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]