SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010176 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010176
Domain Number 1 Region: 280-367
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-22
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 2 Region: 95-162
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000108
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010176   Gene: ENSEEUG00000011167   Transcript: ENSEEUT00000011159
Sequence length 375
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4527:3980:16290:-1 gene:ENSEEUG00000011167 transcript:ENSEEUT00000011159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEMSEKENEPDDAATHSPPGTVSVLQETKLQRFKRTLSLKTILRSKSVENFFLRSGSEL
KCPTEVLLTPPTPLPPPSPPPASTERGLPTHTPSPCPIPRPLAPLKPVRLHSFQEYVFKR
ASPCELCHQLIVGNSKQGLRGKTCKVSVHLWCSEISHQQCPSKTSISFRRNFSSPLLVHE
PPPTCPPIKESPPTGTGGKVDPVYETLRYGTSLALMNRSSFSSTSESPTLSLSERDELAE
DGEGSIRSSEEGPGDSSSVFTAPTESEGSGTEDKSPGQPLPKPPLRKDVGPMYSYVALYK
FLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQPF
AGNKEQGYMSLKENQ
Download sequence
Identical sequences ENSEEUP00000010176 ENSEEUP00000010176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]