SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010237 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010237
Domain Number 1 Region: 28-211,292-449
Classification Level Classification E-value
Superfamily L domain-like 3.65e-53
Family Ngr ectodomain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 1144-1334
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-41
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 613-695
Classification Level Classification E-value
Superfamily L domain-like 1.22e-17
Family Ngr ectodomain-like 0.00035
Further Details:      
 
Domain Number 4 Region: 783-886
Classification Level Classification E-value
Superfamily L domain-like 1.7e-17
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 5 Region: 1072-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000235
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 6 Region: 915-956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000508
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 7 Region: 958-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000222
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 995-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000883
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 1330-1371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010237
Domain Number - Region: 1421-1449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000116
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1373-1410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000442
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010237   Gene: ENSEEUG00000011155   Transcript: ENSEEUT00000011223
Sequence length 1530
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4786:55460:334989:1 gene:ENSEEUG00000011155 transcript:ENSEEUT00000011223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGWQTLPLSLGLVLALLSEVSPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPE
LLFLGTSKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCXXXXXXXXXXXXXXX
XLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPE
TITEIRLEQNSIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKI
TELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLR
AIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSA
KEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLTKFPDHIPQYTAELXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXMLRSNRISCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHALSTLN
LLANPFNCNCYLAWLGEWLRRKRIVTGNPRCQRPYFLKEIPIQDVAIQDFTCDDGNDDNS
CSPLSRCPTECTCLDTVVRCSNKGLKTLPKGIPRDVTEXXXXXXXXXXXXXXXXXXXXXX
XXDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLXXXXXXXXXX
XXXXXXXXXXXXXXAIGANPLHCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTT
PSKKFTCQGPVDVSILAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDVPIHA
CISNPCKHGGTCHLKEGEKDGFWCICADGFEGENCEINIDDCEDNDCENNSTCVDGINNY
TCLCPPEYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCDCTPGYVDEHCDVDFDDC
QDNKCKNGAHCTDAVNGYTCTCPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRI
NEPVCQCLPGYQGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDSGILLYK
GDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGS
PKIITNLSKQSTLNFDSPLYVGGMPGKNSVAAALRQGPGKNGTSFHGCIRNLYINSELQD
FRKVPMQTGILPGCEPCHKKVCAHGTCQPSSQSGFTCECEEGWMGPLCDQRTNDPCLGNK
CVHGTCVPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECS
SGYTGDSCDREISCQGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKR
RKYSFECTDGSSFVDEVEKVVKCGCTPCAS
Download sequence
Identical sequences ENSEEUP00000010237 ENSEEUP00000010237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]