SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010277 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010277
Domain Number 1 Region: 284-400
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-28
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily RING/U-box 1.52e-21
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 94-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010277   Gene: ENSEEUG00000011271   Transcript: ENSEEUT00000011266
Sequence length 409
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5951:6:4859:-1 gene:ENSEEUG00000011271 transcript:ENSEEUT00000011266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVELARKLQEEATCSICLDYFTDPVMTACGHNFCRECIQLTWEKSKGKKGRRKRRGTF
PCPECRELSPQRNLRPNRLLTKVAEMARQHPGLRKSDLCRVHQELLKLYCEDDQNPICVV
CRESREHRTHRVLPVEEAVQEYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXIVPEFRKASLLVAEEKQRLLLTMQRRETASRLQGSRAALEQQGHSLEMLLLRLEDQ
GGHTPLQMLKDMKDYQERRSSLNLQYPEATTTVLRTVCRVPGQIEMLRSFQEDVVPDPTT
AYPYLVLYESRQRHYLSTLPDETPCSQDRFLAYPCAVGKEAFSSGRHYWEVGMNLTGDAL
WALGVCRDNVSRRDRVPKSPENGFWVVQLSKGKKYASVLPTLSPITITE
Download sequence
Identical sequences ENSEEUP00000010277 ENSEEUP00000010277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]