SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010328 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010328
Domain Number 1 Region: 287-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-65
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily RING/U-box 7.51e-21
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 94-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000153
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010328   Gene: ENSEEUG00000011341   Transcript: ENSEEUT00000011324
Sequence length 491
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8404:51715:62139:1 gene:ENSEEUG00000011341 transcript:ENSEEUT00000011324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRAPWERLHEEARCPVCLDFLQDPVSVDCGHSFCLRCISEFCDRSDGALGAIYSCPQC
RGPFDRSSFRPNRQLAGLVESVRQLGLGPGLGTEHARTRCCASHGEELTRFCEDDQEVLC
WVCDTGPEHLAHRTLPLQEAAQSHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXGVRGALNRSQSVTQLELENTPMELKTLCRIPGMREMLRKFQVDVKL
DPATAHPSLLVTTDLRRVQDGELWRDVPNNPERFDTWPCILGLQSFSSGRHYWEVRVEGR
AEWGLGVCQDTVQRKGETTPSPENGVWAIWLLKGNEYMVLASPSVPLLHLERPRCIGIFL
DYEAGEISFYNMSTGSYIYTFNQLFSGHLRPYFFICDMTPFNLPPITETESENWSSIDPA
GPDCSIRDDHS
Download sequence
Identical sequences ENSEEUP00000010328 ENSEEUP00000010328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]