SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010378 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010378
Domain Number 1 Region: 458-611
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-40
Family Protein kinases, catalytic subunit 0.000000278
Further Details:      
 
Domain Number 2 Region: 56-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-26
Family Ras-binding domain, RBD 0.000014
Further Details:      
 
Domain Number 3 Region: 131-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000123
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010378
Domain Number - Region: 335-369
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000882
Family Protein kinases, catalytic subunit 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010378   Gene: ENSEEUG00000011360   Transcript: ENSEEUT00000011376
Sequence length 648
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3601:107:23071:-1 gene:ENSEEUG00000011360 transcript:ENSEEUT00000011376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIQGAWKTLSNGFGFRDAVFDGPSCISPTLGQQFGYQRRASDDGKLTDSSKTNSTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSSVGDSGAPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPASEGSLSQRQRSTSTPNVHMVSTTLPVDSRVIEDAIRSHSESASPTALSSSPNNL
SPTGWSQPRAPVPAQRERAPGPGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDDNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTAPRLPVF
Download sequence
Identical sequences ENSEEUP00000010378 ENSEEUP00000010378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]