SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010412 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010412
Domain Number 1 Region: 380-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-16
Family Laminin G-like module 0.033
Further Details:      
 
Domain Number 2 Region: 590-741
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-16
Family Laminin G-like module 0.051
Further Details:      
 
Domain Number 3 Region: 114-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000644
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 4 Region: 282-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000138
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 5 Region: 789-923
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000317
Family Laminin G-like module 0.0096
Further Details:      
 
Domain Number 6 Region: 73-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1131-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000244
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 8 Region: 320-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 9 Region: 152-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000328
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 42-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000471
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010412
Domain Number - Region: 762-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000377
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 1099-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0137
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 220-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 263-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0368
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 806-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0409
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010412   Gene: ENSEEUG00000011381   Transcript: ENSEEUT00000011413
Sequence length 1240
Comment pep:novel scaffold:HEDGEHOG:scaffold_375522:50010:75922:-1 gene:ENSEEUG00000011381 transcript:ENSEEUT00000011413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVPPQTLSACASAPCPPGTECQETESGGYICGPLEPRGCGTQPCHHGALCVPQGPDPNGF
RCYCVPGFQGPRCELDIDECASQPCHHGATCRNLADRYECHCPLGYAGLTCEEEVDECAS
APCLHGGSCLDGVGSYRCVCAPGYGGASCQLDLDECQSQPCAHGGVCHDLVNGVRCDCAD
TGYEGARCELVLECASAPGHNAWLGGFGSGCLCSYSGARCEVDEDECAAGPCLHGGRCLQ
RSDPALYAGGAAIFPGGFSFARAAGFLCRCPPGFEEADCGVDVDECSSQPCLNGGRCQDL
HNSFQCHCPDGYTGLTCQEDVNECLSQPCLHGGTCEDSVAAYICWCPQAWGGQDCSVQLT
GCQGHTCPLSATCIPTFESGVHDYACHCPPGTHGPSCDQNTTFSVVAGSPAQALVPAGGP
LGLVLRFRTTISAGVLATRTDTWDRLELALEQATLQATLWSHGNTVLVLRLPSQALNDSH
WHPVEVIFRLGLLELRLWHEDCPAQLCMASQPVAPGLTAAMAQTAARPSSVLLGGMDFVG
CLQDVYVDGNLLLPEDLSGTVVLGCERREQCSPPPCAHGAACVDLWTHFQCDCPRPYLGP
TCMDEVPAATFGLGGTLSSASFLLPLPGPNLTISFLLRTREAAGLLLQFTNDSATVLTVF
LSEGQIWTQAPDSPAQALPGRWDDGHRHLVILSVGPDQLQGPVQQVHVGGRCLPADAQPW
GGHFRGCLQDLRLNDLHLPFFPLGNSSQLDEPGTRQAWNLTTGCISEDTCSPDPCLNGGT
CQVTWNDFHCTCPANFTGPTCAQQLWCPGQPCLPPATCEEVPGGFVCVAEATFQEGPPAE
FSGQNVSSGRALGSLSLAFRTRDPEAGLLRATGTQASLWLAVRGGFLAAGVRAGTGLPGA
VLSAPGPRVADGAWHRVRLALERPAAAAARWLQWLDGAATPVALRGLAXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXIPILPEECRLNFTCLDGAPCKSGPQGTNCTCQEGLAGQRCQLPCEANPCLNG
GTCRAADGVYECICSTRFSGQFCEVVKDLPLPLPFPLLEVVVPATCACLLLLLLGLLSGI
LAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences ENSEEUP00000010412 ENSEEUP00000010412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]