SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010423 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010423
Domain Number 1 Region: 828-905
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000229
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Domain Number 2 Region: 1034-1071
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000171
Family SAM (sterile alpha motif) domain 0.083
Further Details:      
 
Domain Number 3 Region: 948-1001
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000314
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010423   Gene: ENSEEUG00000011376   Transcript: ENSEEUT00000011426
Sequence length 1189
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4674:7831:45115:1 gene:ENSEEUG00000011376 transcript:ENSEEUT00000011426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCEVMPTINEGDPLGPPHSADADANFEQLMVNMLDEREKLLESLRESQETLAATQSRLQD
ALHERDQLQRHLNSALPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLLEHLEC
LVSRHERSLRMTVVKRQAQSPSGVSSEVEVLKALKSLFEHHKALDEKVRERLRAALERVT
TLEEQLAGAHQQVSALQQGAGLRDGLEEEGPAELGPKRPWKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXATSIHDLNDKLENELANKESLHRQCEEKARHLQELLEVAEQKLQQTMRKA
ETLPEVEAELAQRIAALTKAEERHGNIEEHLRQLEGQLEEKNQELARVRQREKMNEDHNK
RLSDTVDRLLSESNERLQLHLKERMAALEEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDWESSALPGVLAPTATPAFDSD
PEISDVDEDEPGGLVSSMDVVSPSGHSDAQTLAMMLQEQLDAINEEIRMIQEEKESTELR
AEENETRVTSGSMEALNLSQRRKRGSIPTSLTALSLASASPPLSGRSTPKLTSRSAAQDL
DRMGVMTLPSDLRKHRRKLLSPVSREENREDKATIKCETSPPSSPRTLRLEKLGHPALSQ
EEGKSASEEQGSNPSSSNSSQDSLHKGVKRKGIKSSIGRLFGKKEKGRLIQLSQDAATGH
GLCPFPVLLTDSELSLQEPLVPAKLGTQAEKDRRLKKKHQLLEDARRKGMPFAQWDGPTV
VSWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNALHRLKLRLAIQEMVS
LTSPSAPPTSRTSSENVWVTHEEMKTLATSSKTDSEEGSWAQTLAYGDMNHEWIGNEWLP
SLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVLVWTNDQVVHWVQSIGLRDYAGNLRESGVHGALLALDDNFAHHTL
ALVLQIPTQNTQXXXXXXXXXXXXXXXXXXXXXXXGEDKVFRRAPSWRKRFRPRDPHGSG
LLSTSAETLPAGFRVAALGPLQPAPGPPKKITPEDSHYLYGHMLAAFRD
Download sequence
Identical sequences ENSEEUP00000010423 ENSEEUP00000010423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]