SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010529 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010529
Domain Number 1 Region: 9-151
Classification Level Classification E-value
Superfamily L domain-like 1.34e-27
Family Ngr ectodomain-like 0.033
Further Details:      
 
Domain Number 2 Region: 646-698
Classification Level Classification E-value
Superfamily RING/U-box 0.00000459
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010529
Domain Number - Region: 549-586
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000408
Family SAM (sterile alpha motif) domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010529   Gene: ENSEEUG00000011511   Transcript: ENSEEUT00000011542
Sequence length 705
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5019:387:55319:1 gene:ENSEEUG00000011511 transcript:ENSEEUT00000011542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKEAGADDILDISKCELSEIPFGAFATCKVLQKKVLIVHTNHLTSLLPKSCSLLSLATIK
VLDLHDNQLTALPEDTGQLTALQVLNVERNQLTYLPHSIGNLIQLQTLNLKDNKLKELPD
TLGELRSLRTLDISENEIQRLPQMLAHVRTLEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSGLEYYPPSQYLLPVLEQDGAENSQDSPDGPTNRFSREEVAWQNRFSDYEKRKEQKM
LEKLEFERRLELGQREHAQLLQQSNTQKDEILQTVKEEQSRLEQGLSEHQRYLDTERQRL
QEQLKRTEQSISSRIQKLLQENQRQKKTSEILKSLENEXXXXXXXXXXXXXXXXXXXXXX
XXXAMQQMLTESCKSRLIQMAYESQRQSLVQQACSSMAEMDERFQQILSWQQMDQNKAIS
QILQESTMQKAAFEALQVKKDLMHRQIRNQIKLIETELLQLTQLELKRKSLDTEALQEMV
SEQRWALSSLLQQLLKEKKQREEELREILTELEAKSETKQENYWLIQYQRLLNQKPLSLK
LQEEGMERPLAALLVELSAEHYLPIFAHHRISLDTLSRMNPSDLAKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLLKPPKGGILSTLELPTASEEDIPESVSPSAPPSELEVPTSECVVC
LEREAQMIFLNCGHVCCCQQCCQPLRTCPLCRQDIAQRLRIYHSS
Download sequence
Identical sequences ENSEEUP00000010529 ENSEEUP00000010529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]