SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010600 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010600
Domain Number 1 Region: 209-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-36
Family MAM domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-32
Family MAM domain 0.0052
Further Details:      
 
Domain Number 3 Region: 170-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010600   Gene: ENSEEUG00000011634   Transcript: ENSEEUT00000011617
Sequence length 346
Comment pep:novel scaffold:HEDGEHOG:scaffold_376830:58208:66940:-1 gene:ENSEEUG00000011634 transcript:ENSEEUT00000011617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFEANNCGWFEAISGDHFDWVWSSRGDLSADAEQQAPPGDHTHGTTQGNFMFILKESNS
LSQVAKLQSPTFSQAGPGCMLSFWFYNYGLSVGAAELQLHLEKSGDSTVLWRVLYNQGNQ
WSQATIQLGRLAQPFHLSLNKVSLGIYNGVSAIDDIRFENCTLPHSVESCEGPDNFWCEH
TKACIERLHVCDLVDDCGDNTDENDCTPALQCNFENGICNWEQATDDDFDWTRNQGPTTT
PNTGPMKDNTLGTAKGHYLYIESSEPQVFQNTAALLSPILNATTPEGCTFRFYYHMFGKH
IYRLAVYQRVWSNTKGQLLWQIFGNQGNRWMRQHLHISSRQPIQVW
Download sequence
Identical sequences ENSEEUP00000010600 ENSEEUP00000010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]