SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010607 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010607
Domain Number 1 Region: 13-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.89e-39
Family Regulator of chromosome condensation RCC1 0.005
Further Details:      
 
Domain Number 2 Region: 517-622
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-25
Family beta-lactamase inhibitor protein-II, BLIP-II 0.067
Further Details:      
 
Domain Number 3 Region: 1040-1129
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.75e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 4 Region: 1134-1242
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.01e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 5 Region: 920-1007
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000113
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 6 Region: 1469-1556
Classification Level Classification E-value
Superfamily VPS9 domain 0.0000112
Family VPS9 domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010607
Domain Number - Region: 1607-1637
Classification Level Classification E-value
Superfamily VPS9 domain 0.00183
Family VPS9 domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010607   Gene: ENSEEUG00000011557   Transcript: ENSEEUT00000011625
Sequence length 1638
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_957:85564:154850:-1 gene:ENSEEUG00000011557 transcript:ENSEEUT00000011625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTEAEGSKERGLVCIWQAGSHSLTPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGELPWRSEPAEICTGKPILENALAGQHVITVATGSFHTGAVTESGVVYMWGDNSA
GQCAVADQRYVPEPSPISISDSETSPLLAVRILQLACGEEHTLALSLSREIWAWGTGCQL
GLITSTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDRKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLXESQAENKASTGISPSADTLSQGEVFDNTLVDDQPVAADRK
VENGQTTSSDAIFSQQDIKGATEIPSARNTPSHLDTQTVTEGAQKPSSQSVRENTEKEEK
SVSSQPLVEEVIPGLHSPPTTATSALNSLVVSCASAVGVRVAATYEAGALSLKKVMNFYS
PAPGDLGAQVGSAPIGPEGLKDSREEQVKQESMQGKKSSSLMDIREEESEGGSRRLSLPG
LLSQVSPRLLRKAARVRTRTVVLTPTYSGEADALLPSLRTEVWTWGRGKEGQLGHGDVLH
RLQPLCVKCLDGKEVIHLEAGAYHSLALTAKSQVYSWGNNTFGQLGHSDCPTTVPRLAKV
NGENGFWSVAAGQDYSVFLVDTEDFQPGLYYSGRQDSTEGDNFPDTHSGIKTPVLLSCSK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXTSPEYQKLQDSSACYESLALHLGRKRKEAEYTLGFWKTFPGKMTDSL
RKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAEPLSEE
AGGVNGLKITTPEEQFILISSTPQEKTKWLRAISQAVDQALRGTSDLPPFGSSSSIQRQE
PPISRSAKYTFYKDPRLKDATYDGRWLSGKPHGRGILKWPDGKMYSGMFRNGLEDGYGEY
KIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSSS
PSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLNKM
MGNGVLLSEDDTIYEGEFSDDWTLTGKGTLTMPNGDYIEGYFSGEWGSGIKVTGSYFKPT
LYESDKDKSKVFRKLGNLAVPADEKWKAVFDECWRQLGCENAGQGEVWKAWDSIAVALTT
NRRQHKDSPEILSRSQTQTLESLEYIPKHVGAFSVEKYDDIKKYLIKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLFPELPEEGSTIPLSAPLP
TERKSFCSVKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDVYWEC
VLRLNKQPDTALLGFLGVQRKFWPVTLSILGESKKVLPTTKDACFASAIECLQQIXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRNLGSEVYLIEDL
MDPYLQHGEQGIMFTTLK
Download sequence
Identical sequences ENSEEUP00000010607 ENSEEUP00000010607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]