SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010721 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010721
Domain Number 1 Region: 68-195
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000271
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010721   Gene: ENSEEUG00000011741   Transcript: ENSEEUT00000011749
Sequence length 698
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5019:60851:99124:-1 gene:ENSEEUG00000011741 transcript:ENSEEUT00000011749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDVLSTHLDDARRQHIAEKTGKILAEFLRFYEDQYGVALFNSMRHEVEGTGLPQAQLLW
RKVPLDERVIFSGNLFQYQEDNKKWRNRFSLVPHNYGLVLYENKAAYERQISPRAVINSA
GYKILTSVDQYLELVGNSLPGITAKSGTTPILKCPTQFPLILWHPYARHYYFCLMTETEQ
YKWQAVLQDCIRHCNNGIPENSKVEGPAFTDAIRMYRQSKEQYGTWEMLCGNEVQILSNL
VMEELGPELKAELTPRLKGKPQERQRQWIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDIFFKEVTDMNLNVINEGGIDKLGEYMEKLSQLAFHPLKMQSCYEKMEPLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRILERVLKKY
DYDSSSVRKRFFREALLQITIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSMVMHNSDPNLHLLAEGAPIDWGEEYSGDSGGG
GDSSSPRTPEAVTPPEKRWRAKQVVSMVQDEEAGLPLEASAELELPSPASPDSVTELCGL
LAQDPQAESSLPNGAPALESPQPEAVVQETPSPTSTIQ
Download sequence
Identical sequences ENSEEUP00000010721 ENSEEUP00000010721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]