SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010765 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010765
Domain Number 1 Region: 343-542
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-55
Family Protein kinases, catalytic subunit 0.0000000139
Further Details:      
 
Domain Number 2 Region: 143-255
Classification Level Classification E-value
Superfamily SH2 domain 9.42e-31
Family SH2 domain 0.000000457
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-29
Family SH2 domain 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010765   Gene: ENSEEUG00000011791   Transcript: ENSEEUT00000011795
Sequence length 551
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2508:322:12428:1 gene:ENSEEUG00000011791 transcript:ENSEEUT00000011795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGDALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
SQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLREACPNASASASSGAAAPTLPTHPSTFTHAQRRIDTLNSDGYTPEPARPV
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLMADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKHSTEKADKDEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLLGKKEEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSFGITMEAFSYGQKLYK
AGTGREMKGAG
Download sequence
Identical sequences ENSEEUP00000010765 ENSEEUP00000010765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]