SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010780 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010780
Domain Number 1 Region: 857-1119
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-67
Family Protein kinases, catalytic subunit 0.00000653
Further Details:      
 
Domain Number 2 Region: 548-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-46
Family Protein kinases, catalytic subunit 0.0000644
Further Details:      
 
Domain Number 3 Region: 371-442
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000215
Family SH2 domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010780   Gene: ENSEEUG00000011781   Transcript: ENSEEUT00000011812
Sequence length 1132
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1265:23682:105301:1 gene:ENSEEUG00000011781 transcript:ENSEEUT00000011812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMACLTVTEMEGTSTTPVHQNGDIPISASSVKQIDPVLQVYLYHYLGKAEGDYLKFPAG
EYAAEEICVAASKACGITPVYHSMFALMSETERIWYPPNHVFHLDESTRHNVLYRIXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIRQF
GQCKATARNLKLKYVINLEALQSAFYTEQFEVKEPGRGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPRVLENIQSNCHGPISVDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXNESLGQGTFTKIFKGIRREIGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLEVAKQLAWA
MHFLEEKVLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISVTVLPKDILQERIPWVP
PECIENPKHLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTEL
ANLINNCMDYEADFRPSFRAIIRDLNSLFTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKRLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKSNGRLPRPDGCPDEIYVIMTECWNNNVNQRPAFRDLALRVDQIRDNMTG
Download sequence
Identical sequences ENSEEUP00000010780 ENSEEUP00000010780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]