SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010816 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010816
Domain Number 1 Region: 740-967
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-59
Family DBL homology domain (DH-domain) 0.00000000108
Further Details:      
 
Domain Number 2 Region: 343-473
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.02e-51
Family Regulator of G-protein signaling, RGS 0.0000432
Further Details:      
 
Domain Number 3 Region: 971-1063
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-24
Family Pleckstrin-homology domain (PH domain) 0.0000178
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000010816
Domain Number - Region: 30-66
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00769
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010816   Gene: ENSEEUG00000011770   Transcript: ENSEEUT00000011852
Sequence length 1513
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8337:50831:146897:1 gene:ENSEEUG00000011770 transcript:ENSEEUT00000011852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLKKPIRHGSILNRESPTDKKQKVERSSSHDFDPTGLVQRCVIIQKDDNGFGLTVSGDN
PVFVQSXXXXXXXXXXXXXXXXXXXXXXXVNGTLVTHSNHLEVVKLIKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEENNVVHNQKVD
ILRKMLQKEQERLQSLQEDYNRTPTQRLLKEIREAKKHIPQLQEQLSKATGSAQXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDAHSLSGSPATRVAPHIIGAEDDDFGAEHEQINGQCSCFQSVELLKSRPAHLAV
FLHHVVSQFDPAALLCYLYSDLYKQTNSKETRRVFLEFHQFFLDRSAHLKVSVPDEISVD
LEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTMQYVILMYMKHLGVKVKEPRNLEH
KRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSILGPPRRPSRHDNSAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXAKFRQGGPASEGARTGYLPANSMSSLASGATLSQEGGKENDTGS
KQVGEAPASGDSLDGAPRTSNTYFDFPAPPLDQVQEEESEVERVAEHGTPKPFRKFDSLA
FGESQSEDEQFENDLETDPPNWQQLVSREVLMGLKPCEIKRQEVINELFYTERAHVRTLK
VLDQVFYQRVSREGILSPSELRRIFSNLEDILQLHIRLEHMKAVRKRNETSGIDPIEDLL
TWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQLKDI
IPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVKEAENKQRLED
YQRRLDTSNLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLEDILVL
LQKQDDRLVLRCHSKILASTADSKHTFSPVIKLNTVLVRQVATXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXWQDLICQMAASVKEQSTKPIPLPQSSPCEGDHDEEAPPLKVEHHGIS
VSGMQSSDRDLGLESSLISSKPQSHLLVTSGKSEVDDLFVAEQQFAKEQHADGTLKEAGM
NYQITTPDPHLPVSEERWALDALRNLGLLKQLLVQQLGLTEKCAQEDWPHFAGHRTASPA
AQADGGTQNSENVKTCHPGEGPVPFRTGTDDPTCYSPRTSTESSAPADLVALAFQESQGS
NNLLMDHVITAPEVPPAEPEGGLDESGEHFFDAHEAHGDDNPSEGDGAAKKVEKDVNLRI
SGNYLILDGYETVQESSTDEEVASSVPPQSTTGISSMDSTHQHQHSPRNAHSDGAVSPFT
PEFLVQQRWGAMEDSCFEIQSPSSCADSQSQILEYIHKIEADLEHLKKVEESYTILCQRL
AGSALTVKHSDKS
Download sequence
Identical sequences ENSEEUP00000010816 ENSEEUP00000010816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]