SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010838 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010838
Domain Number 1 Region: 9-64
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000707
Family Ovomucoid domain III-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010838   Gene: ENSEEUG00000011892   Transcript: ENSEEUT00000011874
Sequence length 64
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_329864:3660:6792:-1 gene:ENSEEUG00000011892 transcript:ENSEEUT00000011874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASLPLKTVDCSMYKKYPVVAIPRPITYLPACGSDYINYGNECHLCAENLKSEGKIQFLH
EGKC
Download sequence
Identical sequences ENSEEUP00000010838 ENSEEUP00000010838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]