SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010876 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010876
Domain Number 1 Region: 26-147
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-32
Family Phosphotyrosine-binding domain (PTB) 0.00078
Further Details:      
 
Domain Number 2 Region: 447-518
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-17
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010876   Gene: ENSEEUG00000011884   Transcript: ENSEEUT00000011919
Sequence length 520
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8548:312:8357:-1 gene:ENSEEUG00000011884 transcript:ENSEEUT00000011919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPSSRAIYLNRKEYSQSLATEPTFLQHRVEHLMTCRLGNQRVRKPKDALQKLQEMDAQ
GRVSQTLFLQIKDGWFQLLDIETKVELDSYRLDGIQAIDVALNTCSYNSILSVTVQESGL
PSTSTLLFQCQEVGAEQLKNSLQKVLEEELEQSRPRFGVPHPGQDRWRGPPLERPIPVEQ
KFTLEPGFSPEQPYRMTPEHNTTPSPRQLSRHSSSRELSAFPLPPPNRPPSPEDPEGDEE
VLNHILEDIELLVKKMKEVEAKTTQKKKKKLGKKKKHQEGLTQAQFIDCFQKIKYSFNLL
GKLASRMQEPSAPQLVHILFPTLSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXANWTGSEHQHYRPTFDGWQPPESFNQAPLGYQGSSSLRWGSPQLG
GASHFAQEETHSHGPEDPNIMPSSSRPVKSALKMQVLYEFEARNPQELTVVQGEVLEVLD
QSKRWWLVKNEVGQSGYIPSNILEPLHPRDPGRQSQTPPR
Download sequence
Identical sequences ENSEEUP00000010876 ENSEEUP00000010876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]