SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010914 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010914
Domain Number 1 Region: 227-345
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-35
Family Third domain of FERM 0.00031
Further Details:      
 
Domain Number 2 Region: 862-1009
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-33
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-29
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 4 Region: 531-689
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-27
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010914   Gene: ENSEEUG00000011914   Transcript: ENSEEUT00000011967
Sequence length 1011
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_83:3803:33678:1 gene:ENSEEUG00000011914 transcript:ENSEEUT00000011967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARKMDGTYRALPTPASRLGTRTPAGVSSLEPGQTLTASAQGKCLTVHVRLLDDSMEMLDV
EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKNTVLRLA
VKFFPPDPGQLQEEFTRYLFALQLRRDLREGRLSCTDTTAALLASHLLQAELGDYEETLD
REHLKAHQYLPSQEHCLEKILEFHQKHMGQTPAESDFQVLEVARKLEMYGVRLHAASDRE
GARIHLAAFHTGVLVFQGTTKINTFNWSKVRKLSFRRKRFLVKLHPEAHGPYQDTLEFLL
GSRDACKNFWKVCVEHHTFFRLCDQPKPKAKAVLFSRGSSFRYXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSVSFTESLRTSASPPPADTTPGSLPTSPLAPRGH
LSLQDNSGPQLEPPALDTMRPAAEGSHRAVSAQTPGAPAGPPSPXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLVVDEAYFIAKEILAT
ERTHVKDLEVIAVWFRSAVLKEGARPTQLAAPLFSSIDPMYEFHRNFLRQLEQRLTLHRE
GGALGHQRVGDMLLRNMLQLQALTEHLQRHGEVLAQLEEATRHCGKLEVVRRDFELQRVC
HLPLSAFLLKPLQRPGHYRRLLSRLCRLHGHTDCHXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSPDTTPMEDWEDDAPGPQGSPEGQAQPRAHSTPHVCWYRS
TSVSRADHSAVGQNQLSGYLLRKFKNSGGWQKLWVVFTNFCLFFYKTHQDDHPLASLPLL
GYRVSEAGPGAGGGREHVFKLQFKSHIYFFRAESEYTLSRWMEAIRVASSL
Download sequence
Identical sequences ENSEEUP00000010914 ENSEEUP00000010914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]