SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010956 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010956
Domain Number 1 Region: 31-196
Classification Level Classification E-value
Superfamily EF-hand 1.09e-35
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010956   Gene: ENSEEUG00000012025   Transcript: ENSEEUT00000012012
Sequence length 198
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5291:5872:24025:-1 gene:ENSEEUG00000012025 transcript:ENSEEUT00000012012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIQAKKKLTTTTDPIEKLRLQCLARGSAGIKGLGRVFRIMDDNNNRSLDFKEFIKGLND
YAVVMEREEAEELFRRFDKDGSGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGI
ITIEDLRELYNAKHHPKYQNGDWSEEQVFRKFLDNFDSPYDKDGVVTPEEFMNYYAGVSA
SIDTDVYFIIMMRTAWKL
Download sequence
Identical sequences ENSEEUP00000010956 ENSEEUP00000010956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]