SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000010986 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000010986
Domain Number 1 Region: 447-551
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000411
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 2 Region: 376-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000145
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000010986   Gene: ENSEEUG00000012012   Transcript: ENSEEUT00000012046
Sequence length 1284
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4253:71025:161266:-1 gene:ENSEEUG00000012012 transcript:ENSEEUT00000012046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEEVDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPMEPVKRAPLRQET
NMANFSYRFSIYNLNXXXXXXXXXXXXXXXXXXXXIEQELNSIGAGNSKRQVTETKAAQK
VPSSRHASKHGTLKGLSSSSNKITKPSHANYSLDDITAQLEQASLSMDEAAQQSLLEATK
PAVANQHRRTASAGTVSDAEVRSISNSSRSSVTSAASSMDSLEIDKVMRPQELDLTHQGQ
TITEHAISLRCPSKQAKRHIDFPEEQAELTPHSYLDRETSLLLRNSAGKPSHLLTQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXRIFEDHENLVENLLNWTRDSQNKLLFMERIEKYALFKNPQXXXX
XXXXXXXXXXXXXXXXXXECFCGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYV
PKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCD
DVRTLHQWVNGVRIAKVDYGKQLYINYQEALKRTESAYDWTSLSSSSIKSGSSSSSIPES
QSNHSNQSDSGVSDTQPAGHVRSQSSVSFIFSEAWKRGTQLEESGKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPPPPATAAPAPAPDRGSSPSRKAGKT
ASPGGKKPPPTPQRNSSIRGSSGAEHPEPRGPSVDSLLSRFTAPAQPPGPELPPPKPGKL
NLSGVNLPGSRPGPGGRARDPLREFPSPPSDSDFPPPPPDAELPPPPAELAAFPGGAAPP
VAVVSPQPWCRPQKKAPPPTRPRRNDSTRLTPAEAPEPPAAPPAPTSPKPGLGVQPGFLA
DLNRTLQRKSITRHGSLSSSRASKVEPTATMDDMALPPPPPELLSDQQKAGYAGAQLSGY
ATLRRGPPPAPPKRDQSTKLSRDG
Download sequence
Identical sequences ENSEEUP00000010986 ENSEEUP00000010986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]